Skip to content

Basket

You currently have no items in your basket.

Recombinant Mycobacterium tuberculosis Phosphate-binding protein PstS 1(pstS1),partial

SKU:
CSB-RP149194Ba
Academic Pricing:
Please contact us at info@2bscientific.com for specific academic pricing
Additional Names:
Antigen Ag78 Protein antigen B Short name: PAB
Application:
WB, SDS-PAGE
Buffer:
Tris-based buffer,50% glycerol
Extra Details:
Large sizes and various expression systems are available.
Gene Details:
pstS1
Host:
E.coli
Molecular Weight:
39.8 kDa
Protein Details:
Tag information:N-terminal 6xHis-tagged
Purity:
Greater than 90% as determined by SDS-PAGE.
Sequence:
CGSKPPSGSPETGAGAGTVATTPASSPVTLAETGSTLLYPLFNLWGPAFHERYPNVTITAQGTGSGAGIAQAAAGTVNIGASDAYLSEGDMAAHKGLMNIALAISAQQVNYNLPGVSEHLKLNGKVLAAMYQGTIKTWDDPQIAALNPGVNLPGTAVVPLHRSDGSGDTFLFTQYLSKQDPEGWGKSPGFGTTVDFPAVPGALGENGNGGMVTGCAETPGCVAYIGISFLDQASQRGLGEAQLGNSSGNFLLPDAQSIQAAAAGFASKTPANQAISMIDGPAPDGYPIINYEYAIVNNRQKDAATAQTLQAFLHWAITDGNKASFLDQVHFQPLPPAVVKLSDALIATIS
Shipping Conditions:
Blue Ice
Source:
Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Storage Conditions:
Please refer to datasheet
Supplier:
Cusabio-Flarebio
Size:
10ug
Price for 10ug £433.00

We use cookies to give you the best experience of using this website. By continuing to use this site, you accept our use of cookies. Please read our Cookie Policy for more information.