Skip to content

Basket

You currently have no items in your basket.

Recombinant Mouse Myoglobin(Mb)

SKU:
CSB-MP013529MO
Academic Pricing:
Please contact us at info@2bscientific.com for specific academic pricing
Application:
WB, SDS-PAGE
Extra Details:
Large sizes are available.
Host:
Mammalian cell
Molecular Weight:
21.9 kDa
Protein Details:
Tag information:N-terminal 10xHis-tagged and C-terminal Myc-tagged
Purity:
Greater than 85% as determined by SDS-PAGE.
Research Area:
Cancer
Sequence:
GLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG
Shipping Conditions:
Blue Ice
Source:
Mus musculus (Mouse)
Storage Conditions:
Please refer to datasheet
Supplier:
Cusabio-Flarebio
  • Download:
Price £128.00

We use cookies to give you the best experience of using this website. By continuing to use this site, you accept our use of cookies. Please read our Cookie Policy for more information.