Skip to content

Basket

You currently have no items in your basket.

Human myoglobin recombinant protein from Mammalian cells

SKU:
ATMP00044HU
Academic Pricing:
Please contact us at info@2bscientific.com for specific academic pricing
Application:
ELISA , Western Blot, SDS-PAGE
Buffer:
Protein lyophilized in sterile PBS/Protein store in sterile PBS.
Gene Details:
P02144
Host:
Mammalian cell
Molecular Weight:
18.06kDa
Protein Details:
Met1~Gln153
Purity:
>90% by SDS-PAGE
Sequence:
MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQ
Shipping Conditions:
Blue Ice
Source:
Mammalian cells
Storage Conditions:
Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Supplier:
AtaGenix
Size:
50ug
Price for 50ug £458.00

We use cookies to give you the best experience of using this website. By continuing to use this site, you accept our use of cookies. Please read our Cookie Policy for more information.